Converting ChEMBL to sequence

This page gives you access to a subset of ChEMBL that has been converted to Protein Line Notation. A total of 27142 structures out of 39123 "peptide-like" structures have been successfully converted. More details on the conversion process can be found beneath the structure table.



ChEMBL ID contains
Search is done within records with converted sequences only. Result listing is limited to max. 100 records.
Refresh page with an empty search box to get 100 random structures.

20 randomly selected converted structures

ChEMBL IDChEMBL structureConverted sequence imageProteax PLN (Protein Line Notation)
CHEMBL505609H-RF{d}[Res_3018]TG[Res_1985]FG[MeGly][MeLeu]YPC-OH name=CHEMBL505609
CHEMBL2373052[acetyl]-FLK-[Unknown_terminal_1] name=CHEMBL2373052 inline-mod=C-terminal,[Unknown_terminal_1],H1,QkNGTRECAV/9CQCr/PMA37ILAKv88wEAARhSAgABGg==
CHEMBL1793933[acetyl]-[Res_1724]LD[Res_386]IW-OH name=CHEMBL1793933
CHEMBL228806(cyclo)-{d}FLL{d}V{d}L-(cyclo) name=CHEMBL228806
CHEMBL120263[NTerm_1688]-AV[Asp(pyrrol-1-yl)]DL-OH name=CHEMBL120263
CHEMBL2096796[NTerm_700]-L[Res_594]VG[Res_594]VVI[Res_594]{d}[Res_1979]V[Res_594]VI[Res_594]-[CTerm_810] name=CHEMBL2096796
CHEMBL1085206H-VDKPPYLPRPRPPRRIYNRN-[NH2] name=CHEMBL1085206
CHEMBL505706H-GQVGRQ[Res_625]AIIGDDINR-OH name=CHEMBL505706
CHEMBL448536[acetyl]-H[Res_2539]RW-[NH2] name=CHEMBL448536
CHEMBL447619H-[Res_653][Res_2201]{d}[Res_733]{d}[Res_733]{d}[Res_733]-[NH2] name=CHEMBL447619
CHEMBL1830318H-LRRFSTMPFAFININNVINF-OH name=CHEMBL1830318
CHEMBL343122(cyclo)-RGD{d}RG{d}D-(cyclo) name=CHEMBL343122
CHEMBL3086848H-HS[Res_1274]GTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA-[NH2] name=CHEMBL3086848
CHEMBL1075644[NTerm_1386]-F[Res_2702]L-[NH2] name=CHEMBL1075644
CHEMBL1631335H-RRRRRRRRRFFC-[CTerm_503] name=CHEMBL1631335
CHEMBL429360H-HFRWGK{d}FV-[NH2] name=CHEMBL429360
CHEMBL448088[NTerm_187]-LLL[Res_863]-[CTerm_373] name=CHEMBL448088
CHEMBL1162393[NTerm_546]-R{d}L{d}L[Res_2867]-[NH2] name=CHEMBL1162393
CHEMBL2369912H-CSNLSTCVLGKLSQELD(cyclo1)KL[Res_1170]K(cyclo1)Y{d}PRTNTGSGT{d}P-[NH2] name=CHEMBL2369912
CHEMBL372963[NTerm_887]-[Nle]KAR-[Unknown_terminal_1] name=CHEMBL372963 inline-mod=C-terminal,[Unknown_terminal_1],H1,QkNGTRECAf8SDAAP/6EAf8gNAA//oQEAARhSAgABGg==

Conversion process

All structures in the ChEMBL 19 database were downloaded as an SD file and, with the help of KNIME, probable "peptide-like" structures were identified. The "peptide-like" structures were defined as those containing a substructure of three connected glysines. This yielded a "peptide-like" subset of 39123 structures.

The peptide subset was loaded into a PostgreSQL database table and the Biochemfusion Proteax cartridge was used to convert structures, when possible, to sequences. The first conversion took 87 seconds and produced 27142 converted sequences.

You can download the full set of produced sequences (TAB-separated file with ChEMBL ID + PLN, ~11MB).

All found unknown residues and terminal structures were embedded as inline structures in the first round of produced PLN. The embedded structures were then de-duplicated and extracted. You can download the structure sets in gzip-ed SD file format from here:

143 of the unknown residue structures have been assigned well-defined names by NextMove Software's great Sugar & Splice tool (press the "Biologics" button). Many thanks to Roger Sayle at NextMove Software for processing this subset of residues with Sugar & Splice.

NextMove's residue names can be applied to a Proteax modification database (where the above SD files have been imported) by the following SQL script:

The currently produced PLN has been generated after all the above data has been loaded into Proteax's database of known structures. As you will see, most of the non-natural residues and terminals have auto-generated names based on sequential numbers.