Converting ChEMBL to sequence

This page gives you access to a subset of ChEMBL that has been converted to Protein Line Notation. A total of 27142 structures out of 39123 "peptide-like" structures have been successfully converted. More details on the conversion process can be found beneath the structure table.



ChEMBL ID contains
Search is done within records with converted sequences only. Result listing is limited to max. 100 records.
Refresh page with an empty search box to get 100 random structures.

20 randomly selected converted structures

ChEMBL IDChEMBL structureConverted sequence imageProteax PLN (Protein Line Notation)
CHEMBL544562[NTerm_1185]-VFM-OH name=CHEMBL544562
CHEMBL2371925H-[Res_469]YTA{d}[Res_1979]G-OH name=CHEMBL2371925
CHEMBL1075784[NTerm_1196]-SFS-[CTerm_1086] name=CHEMBL1075784
CHEMBL405648H-FGG[Res_1788]TGARKSARK-[NH2] name=CHEMBL405648
CHEMBL1256561(cyclo)-YYPAGVLS-(cyclo) name=CHEMBL1256561
CHEMBL439706[acetyl]-IC(1)V[Res_300]Q{d}DWGA{d}HRC(1)T-[NH2] name=CHEMBL439706
CHEMBL216617[NTerm_521]-SY{d}[Res_1340]LRP-[CTerm_258] name=CHEMBL216617
CHEMBL269552[acetyl]-ICVWQD{d}[Res_1534]GAHRCT-OH name=CHEMBL269552
CHEMBL2370818[acetyl]-{d}[Res_1340][Res_1788]{d}[Res_1343]S{d}[Res_1465]{d}[Res_1465]L[Res_2151]{d}PA-[NH2] name=CHEMBL2370818
CHEMBL527078H-TPREAARKKRV-OH name=CHEMBL527078
CHEMBL337683H-[Res_2271][Res_1354][Asn(Me2)]A-[CTerm_707] name=CHEMBL337683
CHEMBL118072H-{d}[Res_733]KP[Res_2201]WR-OH name=CHEMBL118072
CHEMBL265595H-DYFGW[N(Me)Nle]DF-[NH2] name=CHEMBL265595
CHEMBL264275H-[PyGlu]GPPISIDLPYVLLRKMIEIEKQEKEKQQAANNRLLLDTI-OH name=CHEMBL264275
CHEMBL2086564[acetyl]-C(1)MPRGC(1)-[NH2] name=CHEMBL2086564
CHEMBL409191(cyclo)-C(1)TKSIPPIC(1)F{d}PDG[Res_141]-(cyclo) name=CHEMBL409191
CHEMBL410000H-[Res_594][Res_594]K{d}K[Res_594][Res_594]K[Res_594][Res_594]{d}KK-[CTerm_947] name=CHEMBL410000
CHEMBL2373485[acetyl]-FK{d}P{d}[Res_2201][Res_1745]{d}R-OH name=CHEMBL2373485
CHEMBL411785[acetyl]-[Res_1340]SK[Res_1340]LDSRRAQDFVQWLMNT-[NH2] name=CHEMBL411785
CHEMBL2370947[NTerm_1296]-FLLR-[NH2] name=CHEMBL2370947

Conversion process

All structures in the ChEMBL 19 database were downloaded as an SD file and, with the help of KNIME, probable "peptide-like" structures were identified. The "peptide-like" structures were defined as those containing a substructure of three connected glysines. This yielded a "peptide-like" subset of 39123 structures.

The peptide subset was loaded into a PostgreSQL database table and the Biochemfusion Proteax cartridge was used to convert structures, when possible, to sequences. The first conversion took 87 seconds and produced 27142 converted sequences.

You can download the full set of produced sequences (TAB-separated file with ChEMBL ID + PLN, ~11MB).

All found unknown residues and terminal structures were embedded as inline structures in the first round of produced PLN. The embedded structures were then de-duplicated and extracted. You can download the structure sets in gzip-ed SD file format from here:

143 of the unknown residue structures have been assigned well-defined names by NextMove Software's great Sugar & Splice tool (press the "Biologics" button). Many thanks to Roger Sayle at NextMove Software for processing this subset of residues with Sugar & Splice.

NextMove's residue names can be applied to a Proteax modification database (where the above SD files have been imported) by the following SQL script:

The currently produced PLN has been generated after all the above data has been loaded into Proteax's database of known structures. As you will see, most of the non-natural residues and terminals have auto-generated names based on sequential numbers.