Converting ChEMBL to sequence

This page gives you access to a subset of ChEMBL that has been converted to Protein Line Notation. A total of 27142 structures out of 39123 "peptide-like" structures have been successfully converted. More details on the conversion process can be found beneath the structure table.

ChEMBL ID contains

Search is done within records with converted sequences only. Result listing is limited to max. 100 records.

Refresh page with an empty search box to get 100 random structures.

20 randomly selected converted structures

ChEMBL ID	ChEMBL structure	Converted sequence image	Proteax PLN (Protein Line Notation)
CHEMBL404042			H-[Res_733]PR-[CTerm_897] name=CHEMBL404042
CHEMBL382983			[NTerm_887]-[Nle]PRR-[Unknown_terminal_1] name=CHEMBL382983 inline-mod=C-terminal,[Unknown_terminal_1],H1,QkNGTRECAT8eBgBV/fAAv9MHAFX98AEAARhSAgABGg==
CHEMBL525993			H-RKRLKWWIY-OH name=CHEMBL525993
CHEMBL265425			[acetyl]-{d}C(1)IP{d}RG{d}DF{d}R{d}C(1)-[NH2] name=CHEMBL265425
CHEMBL442318			H-VPPP[Res_1026]PPRRR-OH name=CHEMBL442318
CHEMBL2369790			[NTerm_283]-SY{d}LLRP-[CTerm_258] name=CHEMBL2369790
CHEMBL1620755			H-[Res_660]VP-[CTerm_390] name=CHEMBL1620755
CHEMBL217327			H-{d}C(1){d}N{d}K{d}LH{d}QV{d}P{d}C(1)N-OH name=CHEMBL217327
CHEMBL412741			(cyclo)-PF{d}FNFYV[Orn]L{d}F-(cyclo) name=CHEMBL412741
CHEMBL607446			(cyclo)-[Res_621]SG[Res_2310][Res_1905][Res_1670]-(cyclo) name=CHEMBL607446
CHEMBL98014			H-YGGF-[CTerm_343] name=CHEMBL98014
CHEMBL412537			H-FGG[Res_472]TGARKSARK-[NH2] name=CHEMBL412537
CHEMBL318382			[NTerm_1157]-GRR-OH name=CHEMBL318382
CHEMBL153466			H-YC(1)F{d}D{d}C(1)VG-[NH2] name=CHEMBL153466
CHEMBL111885			[acetyl]-S[Res_1036]V-OH name=CHEMBL111885
CHEMBL396491			[NTerm_316]-FVP-[CTerm_810] name=CHEMBL396491
CHEMBL500277			H-TPQRARRRKKR[Nle]-OH name=CHEMBL500277
CHEMBL253527			H-RRP{d}[Res_738]IL-OH name=CHEMBL253527
CHEMBL409270			H-HAEGTFTSDVSSYLEGQAAREFIAWLVRGRE[Res_1076]-OH name=CHEMBL409270
CHEMBL577867			[NTerm_59]-F[Res_2036]FL-[CTerm_855] name=CHEMBL577867

Conversion process

All structures in the ChEMBL 19 database were downloaded as an SD file and, with the help of KNIME, probable "peptide-like" structures were identified. The "peptide-like" structures were defined as those containing a substructure of three connected glysines. This yielded a "peptide-like" subset of 39123 structures.

The peptide subset was loaded into a PostgreSQL database table and the Biochemfusion Proteax cartridge was used to convert structures, when possible, to sequences. The first conversion took 87 seconds and produced 27142 converted sequences.

You can download the full set of produced sequences (TAB-separated file with ChEMBL ID + PLN, ~11MB).

All found unknown residues and terminal structures were embedded as inline structures in the first round of produced PLN. The embedded structures were then de-duplicated and extracted. You can download the structure sets in gzip-ed SD file format from here:

N-terminals, 1699 structures, 420 kB
C-terminals, 1270 structures, 333 kB
Residues, 3030 structures, 726 kB

143 of the unknown residue structures have been assigned well-defined names by NextMove Software's great Sugar & Splice tool (press the "Biologics" button). Many thanks to Roger Sayle at NextMove Software for processing this subset of residues with Sugar & Splice.

NextMove's residue names can be applied to a Proteax modification database (where the above SD files have been imported) by the following SQL script:

Residue names update script, 143 name assigments, 18 kB

The currently produced PLN has been generated after all the above data has been loaded into Proteax's database of known structures. As you will see, most of the non-natural residues and terminals have auto-generated names based on sequential numbers.