Converting ChEMBL to sequence

This page gives you access to a subset of ChEMBL that has been converted to Protein Line Notation. A total of 27142 structures out of 39123 "peptide-like" structures have been successfully converted. More details on the conversion process can be found beneath the structure table.

ChEMBL ID contains

Search is done within records with converted sequences only. Result listing is limited to max. 100 records.

Refresh page with an empty search box to get 100 random structures.

20 randomly selected converted structures

ChEMBL ID	ChEMBL structure	Converted sequence image	Proteax PLN (Protein Line Notation)
CHEMBL269735			H-{d}F{d}E{d}Q{d}K{d}IG{d}A{d}W{d}WC{d}A-OH name=CHEMBL269735
CHEMBL1253453			H-EKGKRGTSRNNNIHTNENNIY-OH name=CHEMBL1253453
CHEMBL253364			H-E(cyclo1)H[Res_1340]R{d}WK(cyclo1)-[NH2] name=CHEMBL253364
CHEMBL1770940			H-[Res_224]ARPAK-OH name=CHEMBL1770940
CHEMBL361067			H-GQ[Res_2201]DLADG-OH name=CHEMBL361067
CHEMBL1076065			[NTerm_621]-YYY-[CTerm_1191] name=CHEMBL1076065
CHEMBL2372657			[NTerm_808]-KIFM-OH name=CHEMBL2372657
CHEMBL2370416			[NTerm_700]-{d}[Res_742]PR-[Unknown_terminal_1] name=CHEMBL2370416 inline-mod=C-terminal,[Unknown_terminal_1],H1,QkNGTRECAS9TGwD7/p4ArwgdAPv+ngEAARhSAgABGg==
CHEMBL388109			H-{d}C(1)GGLQPFPQPELPYGG{d}C(1)-OH name=CHEMBL388109
CHEMBL1159675			H-GDFEEIPEE[Res_1873]LQ-OH name=CHEMBL1159675
CHEMBL2403888			[NTerm_700]-[Res_1354][Res_537][Res_1514]-[CTerm_1100] name=CHEMBL2403888
CHEMBL1689457			[acetyl]-FDVC(1)NWVTLPHC(1)KVM-[NH2] name=CHEMBL1689457
CHEMBL375241			H-D{d}[Res_3018](1)F{d}W[Orn]YC(1)V-OH name=CHEMBL375241
CHEMBL1793979			(cyclo)-[Res_78][Aodo][Res_2849]I-(cyclo) name=CHEMBL1793979
CHEMBL204215			H-FPE-OH name=CHEMBL204215
CHEMBL179084			[acetyl]-DELI[Res_2201]C-OH name=CHEMBL179084
CHEMBL1089624			(cyclo)-{d}AI[Res_98]P[Res_1340][Orn]Q-(cyclo) name=CHEMBL1089624
CHEMBL94989			[NTerm_700]-W[Res_1522]DF-[NH2] name=CHEMBL94989
CHEMBL508607			H-[His(1-Me)]SDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-[NH2] name=CHEMBL508607
CHEMBL411466			[NTerm_700]-W[Res_2194]D{d}[Res_733]-[NH2] name=CHEMBL411466

Conversion process

All structures in the ChEMBL 19 database were downloaded as an SD file and, with the help of KNIME, probable "peptide-like" structures were identified. The "peptide-like" structures were defined as those containing a substructure of three connected glysines. This yielded a "peptide-like" subset of 39123 structures.

The peptide subset was loaded into a PostgreSQL database table and the Biochemfusion Proteax cartridge was used to convert structures, when possible, to sequences. The first conversion took 87 seconds and produced 27142 converted sequences.

You can download the full set of produced sequences (TAB-separated file with ChEMBL ID + PLN, ~11MB).

All found unknown residues and terminal structures were embedded as inline structures in the first round of produced PLN. The embedded structures were then de-duplicated and extracted. You can download the structure sets in gzip-ed SD file format from here:

N-terminals, 1699 structures, 420 kB
C-terminals, 1270 structures, 333 kB
Residues, 3030 structures, 726 kB

143 of the unknown residue structures have been assigned well-defined names by NextMove Software's great Sugar & Splice tool (press the "Biologics" button). Many thanks to Roger Sayle at NextMove Software for processing this subset of residues with Sugar & Splice.

NextMove's residue names can be applied to a Proteax modification database (where the above SD files have been imported) by the following SQL script:

Residue names update script, 143 name assigments, 18 kB

The currently produced PLN has been generated after all the above data has been loaded into Proteax's database of known structures. As you will see, most of the non-natural residues and terminals have auto-generated names based on sequential numbers.