Converting ChEMBL to sequence

This page gives you access to a subset of ChEMBL that has been converted to Protein Line Notation. A total of 27142 structures out of 39123 "peptide-like" structures have been successfully converted. More details on the conversion process can be found beneath the structure table.



ChEMBL ID contains
Search is done within records with converted sequences only. Result listing is limited to max. 100 records.
Refresh page with an empty search box to get 100 random structures.

20 randomly selected converted structures

ChEMBL IDChEMBL structureConverted sequence imageProteax PLN (Protein Line Notation)
CHEMBL130002[NTerm_1621]-VPV-[CTerm_586] name=CHEMBL130002
CHEMBL145753[NTerm_691]-V[Res_2708][Res_2861]-[CTerm_828] name=CHEMBL145753
CHEMBL232970H-AIPVSAEEK-OH name=CHEMBL232970
CHEMBL20775H-Y{d}MFHLMD-[NH2] name=CHEMBL20775
CHEMBL384782H-{d}C(1)[Res_2141]F{d}QNC(1){d}PRG-[NH2] name=CHEMBL384782
CHEMBL1836972H-GC(1)C(2)SDPRC(2)RYRC(1)GAA-OH name=CHEMBL1836972
CHEMBL2369785H-[Res_625]SY{d}LLRP-[CTerm_258] name=CHEMBL2369785
CHEMBL576914H-HAEGTFTSD[Res_272][Res_1531]-[NH2] name=CHEMBL576914
CHEMBL1794006H-{d}FHLLREVLE[Nle]ARAEQLAQEAHKNRKL[Nle]EII-[NH2] name=CHEMBL1794006
CHEMBL1649725H-KWKLFKKIEKVGQRVRDAVISAGPAVATVAQATALAK-OH name=CHEMBL1649725
CHEMBL189074H-AV[Res_594]FY-OH name=CHEMBL189074
CHEMBL218433H-[Tyr(3,5-diMe)]PW{d}[Res_1340]-[NH2] name=CHEMBL218433
CHEMBL225409H-[Res_888]L[Res_2606]-[CTerm_766] name=CHEMBL225409
CHEMBL1240540[acetyl]-LQQALFIHFRIGRRRRRRRR-[NH2] name=CHEMBL1240540
CHEMBL522449[NTerm_691]-[Tza]FL-[CTerm_855] name=CHEMBL522449
CHEMBL441915H-AIPVSRERK-OH name=CHEMBL441915
CHEMBL510793[NTerm_658]-{d}[Res_1788]{d}C(1){d}[Res_143]{d}WKTC(1)[Res_1340]-[NH2] name=CHEMBL510793
CHEMBL398116[NTerm_801]-[Orn][Orn]WW-[NH2] name=CHEMBL398116
CHEMBL2029456H-GSSFLSPEHQRVQQ-[NH2] name=CHEMBL2029456
CHEMBL483739[NTerm_128]-[Res_364][Res_364]F-[CTerm_855] name=CHEMBL483739

Conversion process

All structures in the ChEMBL 19 database were downloaded as an SD file and, with the help of KNIME, probable "peptide-like" structures were identified. The "peptide-like" structures were defined as those containing a substructure of three connected glysines. This yielded a "peptide-like" subset of 39123 structures.

The peptide subset was loaded into a PostgreSQL database table and the Biochemfusion Proteax cartridge was used to convert structures, when possible, to sequences. The first conversion took 87 seconds and produced 27142 converted sequences.

You can download the full set of produced sequences (TAB-separated file with ChEMBL ID + PLN, ~11MB).

All found unknown residues and terminal structures were embedded as inline structures in the first round of produced PLN. The embedded structures were then de-duplicated and extracted. You can download the structure sets in gzip-ed SD file format from here:

143 of the unknown residue structures have been assigned well-defined names by NextMove Software's great Sugar & Splice tool (press the "Biologics" button). Many thanks to Roger Sayle at NextMove Software for processing this subset of residues with Sugar & Splice.

NextMove's residue names can be applied to a Proteax modification database (where the above SD files have been imported) by the following SQL script:

The currently produced PLN has been generated after all the above data has been loaded into Proteax's database of known structures. As you will see, most of the non-natural residues and terminals have auto-generated names based on sequential numbers.